Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins) interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain |
Protein Beta-D-xylosidase [101926] (2 species) glycosyl hydrolase family 39 |
Species Bacillus stearothermophilus [TaxId:1422] [141555] (3 PDB entries) Uniprot Q9ZFM2 5-14,362-503 |
Domain d1w91e1: 1w91 E:4-13,E:361-502 [120766] Other proteins in same PDB: d1w91a2, d1w91b2, d1w91c2, d1w91d2, d1w91e2, d1w91f2, d1w91g2, d1w91h2 automatically matched to 1W91 A:4-13,A:361-502 |
PDB Entry: 1w91 (more details), 2.2 Å
SCOPe Domain Sequences for d1w91e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w91e1 b.71.1.2 (E:4-13,E:361-502) Beta-D-xylosidase {Bacillus stearothermophilus [TaxId: 1422]} vnvpsngrekXellyrdgemivtrrkdgsiaavlwnlvmekgegltkevqlvipvsfsav fikrqivneqygnawrvwkqmgrprfpsrqavetlrqvaqphvmteqrratdgvihlsiv lsknevtlieieqvrdetstyvglddgeitsys
Timeline for d1w91e1: