Lineage for d1w91d2 (1w91 D:14-360)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
    glycosyl hydrolase family 39
  7. Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries)
    Uniprot Q9ZFM2 15-361
  8. Domain d1w91d2: 1w91 D:14-360 [120765]
    Other proteins in same PDB: d1w91a1, d1w91b1, d1w91c1, d1w91d1, d1w91e1, d1w91f1, d1w91g1, d1w91h1
    automatically matched to 1W91 A:14-360

Details for d1w91d2

PDB Entry: 1w91 (more details), 2.2 Å

PDB Description: crystal structure of 1,4-beta-d-xylan xylohydrolase solve using anomalous signal from seleniomethionine
PDB Compounds: (D:) beta-xylosidase

SCOPe Domain Sequences for d1w91d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w91d2 c.1.8.3 (D:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]}
fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem
kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl
ivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevtaravksvdphl
qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm
leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf
sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd

SCOPe Domain Coordinates for d1w91d2 are not available.

Timeline for d1w91d2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w91d1
View in 3D
Domains from other chains:
(mouse over for more information)
d1w91a1, d1w91a2, d1w91b1, d1w91b2, d1w91c1, d1w91c2, d1w91e1, d1w91e2, d1w91f1, d1w91f2, d1w91g1, d1w91g2, d1w91h1, d1w91h2