![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Beta-D-xylosidase, catalytic domain [102077] (2 species) glycosyl hydrolase family 39 |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [141780] (3 PDB entries) Uniprot Q9ZFM2 15-361 |
![]() | Domain d1w91b2: 1w91 B:14-360 [120761] Other proteins in same PDB: d1w91a1, d1w91b1, d1w91c1, d1w91d1, d1w91e1, d1w91f1, d1w91g1, d1w91h1 automatically matched to 1W91 A:14-360 |
PDB Entry: 1w91 (more details), 2.2 Å
SCOPe Domain Sequences for d1w91b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w91b2 c.1.8.3 (B:14-360) Beta-D-xylosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} fkknwkfcvgtgrlglalqkeyldhlklvqekigfryirghgllsddvgiyreveidgem kpfynftyidrivdsylalnirpfiefgfmpkalasgdqtvfywkgnvtppkdynkwrdl ivavvshfierygieevrtwlfevwnepnlvnfwkdankqeyfklyevtaravksvdphl qvggpaicggsdewitdflhfcaerrvpvdfvsrhaytskaphkktfeyyyqeleppedm leqfktvralirqspfphlplhiteyntsyspinpvhdtalnaayiarilseggdyvdsf sywtfsdvfeemdvpkalfhggfglvalhsipkptfhaftffnalgd
Timeline for d1w91b2: