SCOP 1.73: Domain d1w8ya1: 1w8y A:1-467

Lineage for d1w8ya1 (1w8y A:1-467)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.3: Dac-like [144040] (3 proteins)
   Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (scop_fa 69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology

6. Protein D-alanyl-D-alanine carboxypeptidase Dac [144043] (1 species)

7. Species Actinomadura sp. [TaxId:1989] [144044] (3 PDB entries)

8. Domain d1w8ya1: 1w8y A:1-467 [120754]
   automatically matched to 1W79 A:1-467
   complexed with mg, ncf, so4

Details for d1w8ya1

PDB Entry: 1w8y, 2.4 Å

PDB Description: crystal structure of the nitrocefin acyl-dd-peptidase from actinomadura r39.

PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOP Domain Sequences for d1w8ya1:

Sequence; same for both SEQRES and ATOM records:

>d1w8ya1 e.3.1.3 (A:1-467) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]}
rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapeg

Timeline for d1w8ya1:

• d1w8ya1 is new in SCOP 1.73
  
• d1w8ya1 appears in SCOP 1.75
  
• d1w8ya1 appears in the current release, SCOPe 2.08, called d1w8ya_