| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
| Protein Archaeal fructose 1,6-bisphosphate aldolase [102088] (1 species) |
| Species Archaeon Thermoproteus tenax [TaxId:2271] [102089] (5 PDB entries) |
| Domain d1w8si1: 1w8s I:3-252 [120752] automatically matched to 1W8S A:3-252 complexed with fbp; mutant |
PDB Entry: 1w8s (more details), 1.85 Å
SCOP Domain Sequences for d1w8si1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8si1 c.1.10.1 (I:3-252) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvesfprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvy
Timeline for d1w8si1: