Lineage for d1w8sf_ (1w8s F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834988Protein automated matches [190095] (28 species)
    not a true protein
  7. 2835355Species Thermoproteus tenax [TaxId:2271] [186816] (2 PDB entries)
  8. 2835370Domain d1w8sf_: 1w8s F: [120749]
    Other proteins in same PDB: d1w8sa1
    automated match to d1ok6a_
    complexed with fbp

Details for d1w8sf_

PDB Entry: 1w8s (more details), 1.85 Å

PDB Description: the mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates
PDB Compounds: (F:) fructose-bisphosphate aldolase class I

SCOPe Domain Sequences for d1w8sf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8sf_ c.1.10.1 (F:) automated matches {Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvesfprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvy

SCOPe Domain Coordinates for d1w8sf_:

Click to download the PDB-style file with coordinates for d1w8sf_.
(The format of our PDB-style files is described here.)

Timeline for d1w8sf_: