| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
| Protein automated matches [190095] (14 species) not a true protein |
| Species Thermoproteus tenax [TaxId:2271] [186816] (1 PDB entry) |
| Domain d1w8sd_: 1w8s D: [120747] Other proteins in same PDB: d1w8sa1 automated match to d1ok6a_ complexed with fbp |
PDB Entry: 1w8s (more details), 1.85 Å
SCOPe Domain Sequences for d1w8sd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8sd_ c.1.10.1 (D:) automated matches {Thermoproteus tenax [TaxId: 2271]}
nltekflrifarrgksiilaydhgiehgpadfmdnpdsadpeyilrlardagfdgvvfqr
giaekyydgsvplilklngkttlyngepvsvancsveeavslgasavgytiypgsgfewk
mfeelarikrdavkfdlplvvesfprggkvvnetapeivayaarialelgadamkikytg
dpktfswavkvagkvpvlmsggpktkteedflkqvegvleagalgiavgrnvwqrrdalk
faralaelvy
Timeline for d1w8sd_: