Lineage for d1w8qb1 (1w8q B:1-466)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 742172Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 742173Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 742577Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (scop_fa 69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 742578Protein D-alanyl-D-alanine carboxypeptidase Dac [144043] (1 species)
  7. 742579Species Actinomadura sp. [TaxId:1989] [144044] (3 PDB entries)
  8. 742589Domain d1w8qb1: 1w8q B:1-466 [120731]
    automatically matched to 1W79 A:1-467
    complexed with co, so4

Details for d1w8qb1

PDB Entry: 1w8q (more details), 2.85 Å

PDB Description: crystal structure of the dd-transpeptidase-carboxypeptidase from actinomadura r39
PDB Compounds: (B:) d-alanyl-d-alanine carboxypeptidase

SCOP Domain Sequences for d1w8qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8qb1 e.3.1.3 (B:1-466) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]}
rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqape

SCOP Domain Coordinates for d1w8qb1:

Click to download the PDB-style file with coordinates for d1w8qb1.
(The format of our PDB-style files is described here.)

Timeline for d1w8qb1: