Lineage for d1w8ha_ (1w8h A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. Protein automated matches [190094] (4 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:287] [186815] (11 PDB entries)
  8. Domain d1w8ha_: 1w8h A: [120726]
    automated match to d1gzta_
    complexed with ca, gol, so4

Details for d1w8ha_

PDB Entry: 1w8h (more details), 1.7500000000000002 Å

PDB Description: structure of pseudomonas aeruginosa lectin ii (pa-iil)complexed with lewisa trisaccharide
PDB Compounds: (A:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d1w8ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8ha_ b.115.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d1w8ha_ are not available.

Timeline for d1w8ha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1w8hb_, d1w8hc_, d1w8hd_