Lineage for d1w8fd1 (1w8f D:1-114)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 679513Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 679514Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) (S)
  5. 679515Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)
  6. 679516Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)
  7. 679517Species Pseudomonas aeruginosa [TaxId:287] [82029] (12 PDB entries)
  8. 679525Domain d1w8fd1: 1w8f D:1-114 [120725]
    automatically matched to d1gzta_
    complexed with bgc, ca, fuc, gal, gol, nag, so4

Details for d1w8fd1

PDB Entry: 1w8f (more details), 1.05 Å

PDB Description: pseudomonas aeruginosa lectin ii (pa-iil)complexed with lacto-n-neo- fucopentaose v(lnpfv)
PDB Compounds: (D:) pseudomonas aeruginosa lectin II

SCOP Domain Sequences for d1w8fd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8fd1 b.115.1.1 (D:1-114) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOP Domain Coordinates for d1w8fd1:

Click to download the PDB-style file with coordinates for d1w8fd1.
(The format of our PDB-style files is described here.)

Timeline for d1w8fd1: