Class b: All beta proteins [48724] (177 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins) automatically mapped to Pfam PF07472 |
Protein automated matches [190094] (4 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries) |
Domain d1w8fc_: 1w8f C: [120724] automated match to d1gzta_ complexed with ca, gol, so4 |
PDB Entry: 1w8f (more details), 1.05 Å
SCOPe Domain Sequences for d1w8fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w8fc_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
Timeline for d1w8fc_: