Lineage for d1w8fc_ (1w8f C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. Protein automated matches [190094] (4 species)
    not a true protein
  7. Species Pseudomonas aeruginosa [TaxId:287] [186815] (11 PDB entries)
  8. Domain d1w8fc_: 1w8f C: [120724]
    automated match to d1gzta_
    complexed with ca, gol, so4

Details for d1w8fc_

PDB Entry: 1w8f (more details), 1.05 Å

PDB Description: pseudomonas aeruginosa lectin ii (pa-iil)complexed with lacto-n-neo- fucopentaose v(lnpfv)
PDB Compounds: (C:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d1w8fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8fc_ b.115.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d1w8fc_ are not available.

Timeline for d1w8fc_:

Domains from other chains:
(mouse over for more information)
d1w8fa_, d1w8fb_, d1w8fd_