Lineage for d1w8fb_ (1w8f B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430565Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2430566Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2430567Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
    automatically mapped to Pfam PF07472
  6. 2430617Protein automated matches [190094] (4 species)
    not a true protein
  7. 2430651Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)
  8. 2430653Domain d1w8fb_: 1w8f B: [120723]
    automated match to d1gzta_
    complexed with ca, gol, so4

Details for d1w8fb_

PDB Entry: 1w8f (more details), 1.05 Å

PDB Description: pseudomonas aeruginosa lectin ii (pa-iil)complexed with lacto-n-neo- fucopentaose v(lnpfv)
PDB Compounds: (B:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d1w8fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8fb_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d1w8fb_:

Click to download the PDB-style file with coordinates for d1w8fb_.
(The format of our PDB-style files is described here.)

Timeline for d1w8fb_: