SCOPe 2.05: Domain d1w8fb_: 1w8f B:

Lineage for d1w8fb_ (1w8f B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (3 proteins)
   automatically mapped to Pfam PF07472

6. Protein automated matches [190094] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [186815] (12 PDB entries)

8. Domain d1w8fb_: 1w8f B: [120723]
   automated match to d1gzta_
   complexed with ca, gol, so4

Details for d1w8fb_

PDB Entry: 1w8f, 1.05 Å

PDB Description: pseudomonas aeruginosa lectin ii (pa-iil)complexed with lacto-n-neo- fucopentaose v(lnpfv)

PDB Compounds: (B:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d1w8fb_:

Sequence; same for both SEQRES and ATOM records:

>d1w8fb_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d1w8fb_:

• d1w8fb_ first appeared in SCOP 1.73, called d1w8fb1
  
• d1w8fb_ appears in SCOPe 2.04
  
• d1w8fb_ appears in SCOPe 2.06
  
• d1w8fb_ appears in the current release, SCOPe 2.08