Lineage for d1w8ea3 (1w8e A:357-511)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303271Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins)
  6. 1303820Protein Spore coat protein A, CotA [89219] (1 species)
  7. 1303821Species Bacillus subtilis [TaxId:1423] [89220] (9 PDB entries)
    Uniprot P07788
  8. 1303839Domain d1w8ea3: 1w8e A:357-511 [120721]
    automated match to d1gska3
    complexed with cu, gol, per

Details for d1w8ea3

PDB Entry: 1w8e (more details), 2.2 Å

PDB Description: 3d structure of cota incubated with hydrogen peroxide
PDB Compounds: (A:) spore coat protein a

SCOPe Domain Sequences for d1w8ea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8ea3 b.6.1.3 (A:357-511) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditdp

SCOPe Domain Coordinates for d1w8ea3:

Click to download the PDB-style file with coordinates for d1w8ea3.
(The format of our PDB-style files is described here.)

Timeline for d1w8ea3: