Lineage for d1w8ea2 (1w8e A:183-356)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 660499Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 660887Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 661298Protein Spore coat protein A, CotA [89219] (1 species)
  7. 661299Species Bacillus subtilis [TaxId:1423] [89220] (12 PDB entries)
  8. 661313Domain d1w8ea2: 1w8e A:183-356 [120720]
    automatically matched to d1gska2
    complexed with cu, gol, per

Details for d1w8ea2

PDB Entry: 1w8e (more details), 2.2 Å

PDB Description: 3d structure of cota incubated with hydrogen peroxide
PDB Compounds: (A:) spore coat protein a

SCOP Domain Sequences for d1w8ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w8ea2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
klpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpy
leveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydi
iidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkyla

SCOP Domain Coordinates for d1w8ea2:

Click to download the PDB-style file with coordinates for d1w8ea2.
(The format of our PDB-style files is described here.)

Timeline for d1w8ea2: