SCOP 1.75: Domain d1w8ea1: 1w8e A:2-182

Lineage for d1w8ea1 (1w8e A:2-182)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Spore coat protein A, CotA [89219] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89220] (12 PDB entries)
   Uniprot P07788

8. Domain d1w8ea1: 1w8e A:2-182 [120719]
   automatically matched to d1gska1
   complexed with cu, gol, per

Details for d1w8ea1

PDB Entry: 1w8e, 2.2 Å

PDB Description: 3d structure of cota incubated with hydrogen peroxide

PDB Compounds: (A:) spore coat protein a

SCOP Domain Sequences for d1w8ea1:

Sequence, based on SEQRES records:

>d1w8ea1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea
wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr
l

Sequence, based on observed residues (ATOM records):

>d1w8ea1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
vkrnenvyvkwmnnlpsthflpidhtihheepevktvvhlhggvtpddsdgypeawfskd
feqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl

Timeline for d1w8ea1:

• d1w8ea1 first appeared in SCOP 1.73
  
• d1w8ea1 appears in SCOPe 2.01
  
• d1w8ea1 appears in the current release, SCOPe 2.08