![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries) |
![]() | Domain d1w8bh_: 1w8b H: [120716] Other proteins in same PDB: d1w8bl_ automated match to d4jzeh_ complexed with 413, ca |
PDB Entry: 1w8b (more details), 3 Å
SCOPe Domain Sequences for d1w8bh_:
Sequence, based on SEQRES records: (download)
>d1w8bh_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdclqqsrkvgdspniteymfcagy sdgskdsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmr seprpgvllrapfp
>d1w8bh_ b.47.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert lafvrfslvsgwgtalelmvlnvprlmtqdclqqsrkvgdspniteymfcagysdgskds ckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrseprpgv llrapfp
Timeline for d1w8bh_: