SCOPe 2.07: Domain d1w87b2: 1w87 B:142-303

Lineage for d1w87b2 (1w87 B:142-303)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein automated matches [226995] (7 species)
   not a true protein

7. Species Anabaena sp. [TaxId:1168] [254932] (3 PDB entries)

8. Domain d1w87b2: 1w87 B:142-303 [120715]
   Other proteins in same PDB: d1w87a1, d1w87b1
   automated match to d1ewya2
   complexed with fad, nap; mutant

Details for d1w87b2

PDB Entry: 1w87, 3 Å

PDB Description: ferredoxin-nadp reductase (mutation: y 303 w) complexed with nadp by cocrystallization

PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d1w87b2:

Sequence; same for both SEQRES and ATOM records:

>d1w87b2 c.25.1.1 (B:142-303) automated matches {Anabaena sp. [TaxId: 1168]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetw

Timeline for d1w87b2:

• d1w87b2 first appeared in SCOP 1.73
  
• d1w87b2 appears in SCOPe 2.06
  
• d1w87b2 appears in the current release, SCOPe 2.08