![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (5 proteins) |
![]() | Protein automated matches [226995] (7 species) not a true protein |
![]() | Species Anabaena sp. [TaxId:1168] [254932] (3 PDB entries) |
![]() | Domain d1w87b2: 1w87 B:142-303 [120715] Other proteins in same PDB: d1w87a1, d1w87b1 automated match to d1ewya2 complexed with fad, nap; mutant |
PDB Entry: 1w87 (more details), 3 Å
SCOPe Domain Sequences for d1w87b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w87b2 c.25.1.1 (B:142-303) automated matches {Anabaena sp. [TaxId: 1168]} lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetw
Timeline for d1w87b2: