Lineage for d1w87a2 (1w87 A:142-303)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859730Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859731Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2859732Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2859820Protein automated matches [226995] (7 species)
    not a true protein
  7. 2859827Species Anabaena sp. [TaxId:1168] [254932] (3 PDB entries)
  8. 2859830Domain d1w87a2: 1w87 A:142-303 [120713]
    Other proteins in same PDB: d1w87a1, d1w87b1
    automated match to d1ewya2
    complexed with fad, nap; mutant

Details for d1w87a2

PDB Entry: 1w87 (more details), 3 Å

PDB Description: ferredoxin-nadp reductase (mutation: y 303 w) complexed with nadp by cocrystallization
PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d1w87a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w87a2 c.25.1.1 (A:142-303) automated matches {Anabaena sp. [TaxId: 1168]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlwqliknqkthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvetw

SCOPe Domain Coordinates for d1w87a2:

Click to download the PDB-style file with coordinates for d1w87a2.
(The format of our PDB-style files is described here.)

Timeline for d1w87a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w87a1