![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
![]() | Protein automated matches [227029] (5 species) not a true protein |
![]() | Species Anabaena sp. [TaxId:1168] [254929] (3 PDB entries) |
![]() | Domain d1w87a1: 1w87 A:9-141 [120712] Other proteins in same PDB: d1w87a2, d1w87b2 automated match to d1quea1 complexed with fad, nap; mutant |
PDB Entry: 1w87 (more details), 3 Å
SCOPe Domain Sequences for d1w87a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w87a1 b.43.4.2 (A:9-141) automated matches {Anabaena sp. [TaxId: 1168]} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgkeml
Timeline for d1w87a1: