SCOPe 2.04: Domain d1w83a_: 1w83 A:

Lineage for d1w83a_ (1w83 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (490 PDB entries)

8. Domain d1w83a_: 1w83 A: [120710]
   automated match to d1a9u__
   complexed with l11

Details for d1w83a_

PDB Entry: 1w83, 2.5 Å

PDB Description: p38 kinase crystal structure in complex with small molecule inhibitor

PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d1w83a_:

Sequence; same for both SEQRES and ATOM records:

>d1w83a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq

Timeline for d1w83a_:

• d1w83a_ first appeared in SCOP 1.73, called d1w83a1
  
• d1w83a_ appears in SCOPe 2.03
  
• d1w83a_ appears in SCOPe 2.05
  
• d1w83a_ appears in the current release, SCOPe 2.08