![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) ![]() |
![]() | Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (3 proteins) |
![]() | Protein Trypsin inhibitor [57029] (5 species) |
![]() | Species Jumping cucumber (Ecballium elaterium) [TaxId:3679] [57033] (7 PDB entries) |
![]() | Domain d1w7zh1: 1w7z H:1-30 [120708] automatically matched to d1h9hi_ complexed with fmt, na |
PDB Entry: 1w7z (more details), 1.67 Å
SCOP Domain Sequences for d1w7zh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7zh1 g.3.2.1 (H:1-30) Trypsin inhibitor {Jumping cucumber (Ecballium elaterium) [TaxId: 3679]} gcprilirckqdsdclagcvcgpngfcgsp
Timeline for d1w7zh1: