Lineage for d1w7zh1 (1w7z H:1-30)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747142Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) (S)
  5. 747143Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (3 proteins)
  6. 747154Protein Trypsin inhibitor [57029] (5 species)
  7. 747158Species Jumping cucumber (Ecballium elaterium) [TaxId:3679] [57033] (7 PDB entries)
  8. 747169Domain d1w7zh1: 1w7z H:1-30 [120708]
    automatically matched to d1h9hi_
    complexed with fmt, na

Details for d1w7zh1

PDB Entry: 1w7z (more details), 1.67 Å

PDB Description: crystal structure of the free (uncomplexed) ecballium elaterium trypsin inhibitor (eeti-ii)
PDB Compounds: (H:) trypsin inhibitor II

SCOP Domain Sequences for d1w7zh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7zh1 g.3.2.1 (H:1-30) Trypsin inhibitor {Jumping cucumber (Ecballium elaterium) [TaxId: 3679]}
gcprilirckqdsdclagcvcgpngfcgsp

SCOP Domain Coordinates for d1w7zh1:

Click to download the PDB-style file with coordinates for d1w7zh1.
(The format of our PDB-style files is described here.)

Timeline for d1w7zh1: