SCOPe 2.08: Domain d1w7zd_: 1w7z D:

Lineage for d1w7zd_ (1w7z D:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family)

5. Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins)

6. Protein automated matches [190093] (4 species)
   not a true protein

7. Species Jumping cucumber (Ecballium elaterium) [TaxId:3679] [186814] (1 PDB entry)

8. Domain d1w7zd_: 1w7z D: [120704]
   automated match to d1h9hi_
   complexed with fmt, na

Details for d1w7zd_

PDB Entry: 1w7z, 1.67 Å

PDB Description: crystal structure of the free (uncomplexed) ecballium elaterium trypsin inhibitor (eeti-ii)

PDB Compounds: (D:) trypsin inhibitor II

SCOPe Domain Sequences for d1w7zd_:

Sequence; same for both SEQRES and ATOM records:

>d1w7zd_ g.3.2.1 (D:) automated matches {Jumping cucumber (Ecballium elaterium) [TaxId: 3679]}
gcprilirckqdsdclagcvcgpngfcgspa

Timeline for d1w7zd_:

• d1w7zd_ first appeared in SCOP 1.73, called d1w7zd1
  
• d1w7zd_ appears in SCOPe 2.07