Lineage for d1w7za_ (1w7z A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030150Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) (S)
  5. 3030151Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins)
  6. 3030197Protein automated matches [190093] (4 species)
    not a true protein
  7. 3030198Species Jumping cucumber (Ecballium elaterium) [TaxId:3679] [186814] (1 PDB entry)
  8. 3030199Domain d1w7za_: 1w7z A: [120701]
    automated match to d1h9hi_
    complexed with fmt, na

Details for d1w7za_

PDB Entry: 1w7z (more details), 1.67 Å

PDB Description: crystal structure of the free (uncomplexed) ecballium elaterium trypsin inhibitor (eeti-ii)
PDB Compounds: (A:) trypsin inhibitor II

SCOPe Domain Sequences for d1w7za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7za_ g.3.2.1 (A:) automated matches {Jumping cucumber (Ecballium elaterium) [TaxId: 3679]}
gcprilirckqdsdclagcvcgpngfcgspa

SCOPe Domain Coordinates for d1w7za_:

Click to download the PDB-style file with coordinates for d1w7za_.
(The format of our PDB-style files is described here.)

Timeline for d1w7za_: