SCOPe 2.07: Domain d1w7xl_: 1w7x L:

Lineage for d1w7xl_ (1w7x L:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries)

8. Domain d1w7xl_: 1w7x L: [120700]
   Other proteins in same PDB: d1w7xh_
   automated match to d1klil_
   complexed with 413, ca, gol, so4

Details for d1w7xl_

PDB Entry: 1w7x, 1.8 Å

PDB Description: factor7 - 413 complex

PDB Compounds: (L:) blood coagulation factor viia

SCOPe Domain Sequences for d1w7xl_:

Sequence, based on SEQRES records:

>d1w7xl_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Sequence, based on observed residues (ATOM records):

>d1w7xl_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d1w7xl_:

• d1w7xl_ first appeared in SCOP 1.73, called d1w7xl1
  
• d1w7xl_ appears in SCOPe 2.06
  
• d1w7xl_ appears in the current release, SCOPe 2.08