Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) |
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) |
Protein Aminopeptidase P [53096] (2 species) synonym: Xaa-Pro dipeptidase, prolidase |
Species Escherichia coli [TaxId:562] [53097] (26 PDB entries) |
Domain d1w7vc1: 1w7v C:1-176 [120695] Other proteins in same PDB: d1w7va2, d1w7vb2, d1w7vc2, d1w7vd2 automatically matched to d1a16_1 complexed with cl, mg, zn |
PDB Entry: 1w7v (more details), 2 Å
SCOP Domain Sequences for d1w7vc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7vc1 c.55.2.1 (C:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d1w7vc1: