Lineage for d1w7jb1 (1w7j B:11-149)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 641106Protein Myosin Essential Chain [47524] (3 species)
  7. 641132Species Human (Homo sapiens) [TaxId:9606] [101181] (3 PDB entries)
  8. 641133Domain d1w7jb1: 1w7j B:11-149 [120690]
    Other proteins in same PDB: d1w7ja1, d1w7ja2
    automatically matched to d1oe9b_
    complexed with adp, bef, mg

Details for d1w7jb1

PDB Entry: 1w7j (more details), 2 Å

PDB Description: crystal structure of myosin v motor with essential light chain + adp-befx - near rigor
PDB Compounds: (B:) myosin light chain 1

SCOP Domain Sequences for d1w7jb1:

Sequence, based on SEQRES records: (download)

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}
efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf
lpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvla
ghedsngcinyeaflkhil

Sequence, based on observed residues (ATOM records): (download)

>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]}
efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf
lpmlqavakdylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvlaghedsngc
inyeaflkhil

SCOP Domain Coordinates for d1w7jb1:

Click to download the PDB-style file with coordinates for d1w7jb1.
(The format of our PDB-style files is described here.)

Timeline for d1w7jb1: