![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (11 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Myosin Essential Chain [47524] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101181] (3 PDB entries) |
![]() | Domain d1w7jb1: 1w7j B:11-149 [120690] Other proteins in same PDB: d1w7ja1, d1w7ja2 automatically matched to d1oe9b_ complexed with adp, bef, mg |
PDB Entry: 1w7j (more details), 2 Å
SCOP Domain Sequences for d1w7jb1:
Sequence, based on SEQRES records: (download)
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf lpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvla ghedsngcinyeaflkhil
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf lpmlqavakdylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvlaghedsngc inyeaflkhil
Timeline for d1w7jb1: