SCOPe 2.08: Domain d1w7jb_: 1w7j B:

Lineage for d1w7jb_ (1w7j B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186813] (11 PDB entries)

8. Domain d1w7jb_: 1w7j B: [120690]
   Other proteins in same PDB: d1w7ja1, d1w7ja2
   automated match to d1oe9b_
   complexed with adp, bef, mg

Details for d1w7jb_

PDB Entry: 1w7j, 2 Å

PDB Description: crystal structure of myosin v motor with essential light chain + adp-befx - near rigor

PDB Compounds: (B:) myosin light chain 1

SCOPe Domain Sequences for d1w7jb_:

Sequence, based on SEQRES records:

>d1w7jb_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf
lpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvla
ghedsngcinyeaflkhil

Sequence, based on observed residues (ATOM records):

>d1w7jb_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf
lpmlqavakdylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvlaghedsngc
inyeaflkhil

Timeline for d1w7jb_:

• d1w7jb_ first appeared in SCOP 1.73, called d1w7jb1
  
• d1w7jb_ appears in SCOPe 2.07