Lineage for d1w7jb_ (1w7j B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995301Protein automated matches [190064] (20 species)
    not a true protein
  7. 1995342Species Human (Homo sapiens) [TaxId:9606] [186813] (23 PDB entries)
  8. 1995343Domain d1w7jb_: 1w7j B: [120690]
    Other proteins in same PDB: d1w7ja1, d1w7ja2
    automated match to d1oe9b_
    complexed with adp, bef, mg

Details for d1w7jb_

PDB Entry: 1w7j (more details), 2 Å

PDB Description: crystal structure of myosin v motor with essential light chain + adp-befx - near rigor
PDB Compounds: (B:) myosin light chain 1

SCOPe Domain Sequences for d1w7jb_:

Sequence, based on SEQRES records: (download)

>d1w7jb_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf
lpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvla
ghedsngcinyeaflkhil

Sequence, based on observed residues (ATOM records): (download)

>d1w7jb_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelksrrvdfetf
lpmlqavakdylegfrvfdkegngkvmgaelrhvlttlgekmteeevetvlaghedsngc
inyeaflkhil

SCOPe Domain Coordinates for d1w7jb_:

Click to download the PDB-style file with coordinates for d1w7jb_.
(The format of our PDB-style files is described here.)

Timeline for d1w7jb_: