Lineage for d1w7ja2 (1w7j A:63-792)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111652Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 2111682Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [102369] (2 PDB entries)
  8. 2111683Domain d1w7ja2: 1w7j A:63-792 [120689]
    Other proteins in same PDB: d1w7ja1, d1w7jb_
    automated match to d1oe9a2
    complexed with adp, bef, mg

Details for d1w7ja2

PDB Entry: 1w7j (more details), 2 Å

PDB Description: crystal structure of myosin v motor with essential light chain + adp-befx - near rigor
PDB Compounds: (A:) myosin va

SCOPe Domain Sequences for d1w7ja2:

Sequence, based on SEQRES records: (download)

>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnka
lhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekpr
lsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekaisp
tsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvrci
kpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdvls
drkqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciriqktirgwl
mrkkymrmrr

Sequence, based on observed residues (ATOM records): (download)

>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnka
lhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekpr
lsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqktvghqfr
nslhllmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsr
wtyqeffsryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylek
iradklraaciriqktirgwlmrkkymrmrr

SCOPe Domain Coordinates for d1w7ja2:

Click to download the PDB-style file with coordinates for d1w7ja2.
(The format of our PDB-style files is described here.)

Timeline for d1w7ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w7ja1
View in 3D
Domains from other chains:
(mouse over for more information)
d1w7jb_