Lineage for d1w7ja2 (1w7j A:63-792)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.9: Motor proteins [52641] (5 proteins)
  6. Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [102369] (2 PDB entries)
  8. Domain d1w7ja2: 1w7j A:63-792 [120689]
    Other proteins in same PDB: d1w7ja1, d1w7jb_
    automated match to d1oe9a2
    complexed with adp, bef, mg

    has additional subdomain(s) that are not in the common domain

Details for d1w7ja2

PDB Entry: 1w7j (more details), 2 Å

PDB Description: crystal structure of myosin v motor with essential light chain + adp-befx - near rigor
PDB Compounds: (A:) myosin va

SCOPe Domain Sequences for d1w7ja2:

Sequence, based on SEQRES records: (download)

>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnka
lhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekpr
lsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekaisp
tsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvrci
kpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdvls
drkqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciriqktirgwl
mrkkymrmrr

Sequence, based on observed residues (ATOM records): (download)

>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnka
lhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekpr
lsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqktvghqfr
nslhllmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsr
wtyqeffsryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylek
iradklraaciriqktirgwlmrkkymrmrr

SCOPe Domain Coordinates for d1w7ja2 are not available.

Timeline for d1w7ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w7ja1
View in 3D
Domains from other chains:
(mouse over for more information)
d1w7jb_