Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) |
Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (2 PDB entries) |
Domain d1w7ja1: 1w7j A:2-62 [120688] Other proteins in same PDB: d1w7ja2, d1w7jb_ automated match to d1oe9a1 complexed with adp, bef, mg |
PDB Entry: 1w7j (more details), 2 Å
SCOPe Domain Sequences for d1w7ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w7ja1 b.34.3.1 (A:2-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} aaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelpp l
Timeline for d1w7ja1: