SCOPe 2.08: Domain d1w7ja1: 1w7j A:2-62

Lineage for d1w7ja1 (1w7j A:2-62)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)

6. Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)

7. Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (2 PDB entries)

8. Domain d1w7ja1: 1w7j A:2-62 [120688]
   Other proteins in same PDB: d1w7ja2, d1w7jb_
   automated match to d1oe9a1
   complexed with adp, bef, mg

Details for d1w7ja1

PDB Entry: 1w7j, 2 Å

PDB Description: crystal structure of myosin v motor with essential light chain + adp-befx - near rigor

PDB Compounds: (A:) myosin va

SCOPe Domain Sequences for d1w7ja1:

Sequence; same for both SEQRES and ATOM records:

>d1w7ja1 b.34.3.1 (A:2-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
aaselytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelpp
l

Timeline for d1w7ja1:

• d1w7ja1 first appeared in SCOP 1.73
  
• d1w7ja1 appears in SCOPe 2.07