SCOPe 2.08: Domain d1w7ib_: 1w7i B:

Lineage for d1w7ib_ (1w7i B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186813] (11 PDB entries)

8. Domain d1w7ib_: 1w7i B: [120687]
   Other proteins in same PDB: d1w7ia1, d1w7ia2
   automated match to d1br1b_
   complexed with adp

Details for d1w7ib_

PDB Entry: 1w7i, 3 Å

PDB Description: crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp

PDB Compounds: (B:) myosin light chain 1, slow-twitch muscle a isoform

SCOPe Domain Sequences for d1w7ib_:

Sequence, based on SEQRES records:

>d1w7ib_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelks
rrvdfetflpmlqavaknrgqgtyedylegfrvfdkegngkvmgaelrhvlttlgekmte
eevetvlaghedsngcinyeaflkhils

Sequence, based on observed residues (ATOM records):

>d1w7ib_ a.39.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efnkdqleefkeafelfdrvgdgkilysqcgdvmralgqnptnaevlkvlgnpksdelks
rrvdfetflpmlqavaknrtyedylegfrvfdkegngkvmgaelrhvlttlgekmteeev
etvlaghedsngcinyeaflkhils

Timeline for d1w7ib_:

• d1w7ib_ first appeared in SCOP 1.73, called d1w7ib1
  
• d1w7ib_ appears in SCOPe 2.07