Lineage for d1w7ia2 (1w7i A:63-795)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 695085Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 695086Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 696444Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 696518Protein Myosin S1, motor domain [52642] (5 species)
    common fold is interrupted with some all-alpha subdomains
  7. 696548Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [102369] (3 PDB entries)
  8. 696551Domain d1w7ia2: 1w7i A:63-795 [120686]
    Other proteins in same PDB: d1w7ia1, d1w7ib1
    automatically matched to d1oe9a2
    complexed with adp

Details for d1w7ia2

PDB Entry: 1w7i (more details), 3 Å

PDB Description: crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp
PDB Compounds: (A:) myosin va

SCOP Domain Sequences for d1w7ia2:

Sequence, based on SEQRES records: (download)

>d1w7ia2 c.37.1.9 (A:63-795) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatatetyikpisklhainardalakhiyanlfnwivdhvnka
lhstvkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqi
pwtlidfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekpr
lsnkafiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqdeekaisp
tsatpsgrvplsrtpvkpakarpgqtskehkktvghqfrnslhllmetlnattphyvrci
kpndfkfpftfdekravqqlracgvletirisaagfpsrwtyqeffsryrvlmkqkdvls
drkqtcknvleklildkdkyqfgktkiffragqvaylekiradklraaciriqktirgwl
mrkkymrmrrgda

Sequence, based on observed residues (ATOM records): (download)

>d1w7ia2 c.37.1.9 (A:63-795) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
rnpdilvgendltalsylhepavlhnlkvrfidskliytycgivlvainpyeqlpiyged
iinaysgqnmgdmdphifavaeeaykqmardernqsiivsgesgagktvsakyamryfat
vsgsaseanveekvlasnpimesignakttrndnssrfgkyieigfdkryriiganmrty
lleksrvvfqaeeernyhifyqlcasaalpefktlrlgnanyfhytkqggspvidgidda
kemvntrqactllgisdsyqmgifrilagilhlgnvefasrdsdscaippkhdpltifcd
lmgvdyeemahwlchrklatyikpisklhainardalakhiyanlfnwivdhvnkalhst
vkqhsfigvldiygfetfeinsfeqfcinyaneklqqqfnmhvfkleqeeymkeqipwtl
idfydnqpcinlieakmgvldlldeeckmpkgsddtwaqklynthlnkcalfekprlsnk
afiikhfadkveyqcegfleknkdtvyeeqikvlksskkfkllpelfqhkktvghqfrns
lhllmetlnattphyvrcikpndfkfpftfdekravqqlracgvletirisaagfpsrwt
yqeffsryrvlmkqkdvlsdrkqtcknvleklildkdkyqfgktkiffragqvaylekir
adklraaciriqktirgwlmrkkymrmrrgda

SCOP Domain Coordinates for d1w7ia2:

Click to download the PDB-style file with coordinates for d1w7ia2.
(The format of our PDB-style files is described here.)

Timeline for d1w7ia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w7ia1
View in 3D
Domains from other chains:
(mouse over for more information)
d1w7ib1