Lineage for d1w7ia1 (1w7i A:5-62)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665407Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 665408Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 665409Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 665439Species Chicken (Gallus gallus), Va isoform [TaxId:9031] [101683] (3 PDB entries)
  8. 665442Domain d1w7ia1: 1w7i A:5-62 [120685]
    Other proteins in same PDB: d1w7ia2, d1w7ib1
    automatically matched to d1oe9a1
    complexed with adp

Details for d1w7ia1

PDB Entry: 1w7i (more details), 3 Å

PDB Description: crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp
PDB Compounds: (A:) myosin va

SCOP Domain Sequences for d1w7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7ia1 b.34.3.1 (A:5-62) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl

SCOP Domain Coordinates for d1w7ia1:

Click to download the PDB-style file with coordinates for d1w7ia1.
(The format of our PDB-style files is described here.)

Timeline for d1w7ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w7ia2
View in 3D
Domains from other chains:
(mouse over for more information)
d1w7ib1