SCOPe 2.08: Domain d1w7ia1: 1w7i A:5-62

Lineage for d1w7ia1 (1w7i A:5-62)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.0: automated matches [227148] (1 protein)
   not a true family

6. Protein automated matches [226852] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [230370] (2 PDB entries)

8. Domain d1w7ia1: 1w7i A:5-62 [120685]
   Other proteins in same PDB: d1w7ia2, d1w7ib_
   automated match to d1oe9a1
   complexed with adp

Details for d1w7ia1

PDB Entry: 1w7i, 3 Å

PDB Description: crystal structure of myosin v motor without nucleotide soaked in 10 mm mgadp

PDB Compounds: (A:) myosin va

SCOPe Domain Sequences for d1w7ia1:

Sequence; same for both SEQRES and ATOM records:

>d1w7ia1 b.34.3.0 (A:5-62) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elytkyarvwipdpeevwksaellkdykpgdkvlqlrleegkdleycldpktkelppl

Timeline for d1w7ia1:

• d1w7ia1 first appeared in SCOP 1.73
  
• d1w7ia1 appears in SCOPe 2.07