Lineage for d1w7ha_ (1w7h A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589707Protein automated matches [190091] (20 species)
    not a true protein
  7. 2589831Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)
  8. 2590673Domain d1w7ha_: 1w7h A: [120684]
    automated match to d1a9u__
    complexed with 3ip

Details for d1w7ha_

PDB Entry: 1w7h (more details), 2.21 Å

PDB Description: p38 kinase crystal structure in complex with small molecule inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 14

SCOPe Domain Sequences for d1w7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7ha_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsii
hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyv
atrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpg
aellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqal
ahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq

SCOPe Domain Coordinates for d1w7ha_:

Click to download the PDB-style file with coordinates for d1w7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1w7ha_: