Lineage for d1w79a1 (1w79 A:1-467)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 883341Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 883342Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families) (S)
  5. 883798Family e.3.1.3: Dac-like [144040] (3 proteins)
    Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family ((69501)) and (d2) six-stranded beta-sandwich with a crossed-loop topology
  6. 883799Protein D-alanyl-D-alanine carboxypeptidase Dac [144043] (1 species)
  7. 883800Species Actinomadura sp. [TaxId:1989] [144044] (3 PDB entries)
    Uniprot P39045 50-516
  8. 883801Domain d1w79a1: 1w79 A:1-467 [120680]
    complexed with mg, so4

Details for d1w79a1

PDB Entry: 1w79 (more details), 1.8 Å

PDB Description: crystal structure of the dd-transpeptidase-carboxypeptidase from actinomadura r39
PDB Compounds: (A:) d-alanyl-d-alanine carboxypeptidase

SCOP Domain Sequences for d1w79a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w79a1 e.3.1.3 (A:1-467) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]}
rltelredidailedpalegavsgvvvvdtatgeelysrdggeqllpasnmklftaaaal
evlgadhsfgtevaaesapgrrgevqdlylvgrgdptlsaedldamaaevaasgvrtvrg
dlyaddtwfdserlvddwwpedepyaysaqisaltvahgerfdtgvtevsvtpaaegepa
dvdlgaaegyaeldnravtgaagsantlvidrpvgtntiavtgslpadaapvtalrtvde
paalaghlfeealesngvtvkgdvglggvpadwqdaevladhtsaelseilvpfmkfsnn
ghaemlvksigqetagagtwdaglvgveealsglgvdtaglvlndgsglsrgnlvtadtv
vdllgqagsapwaqtwsaslpvagesdpfvggtlanrmrgtaaegvveaktgtmsgvsal
sgyvpgpegelafsivnnghsgpaplavqdaiavrlaeyaghqapeg

SCOP Domain Coordinates for d1w79a1:

Click to download the PDB-style file with coordinates for d1w79a1.
(The format of our PDB-style files is described here.)

Timeline for d1w79a1: