Class b: All beta proteins [48724] (174 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins) |
Protein Spore coat protein A, CotA [89219] (1 species) |
Species Bacillus subtilis [TaxId:1423] [89220] (12 PDB entries) Uniprot P07788 |
Domain d1w6wa3: 1w6w A:357-510 [120677] automatically matched to d1gska3 complexed with azi, cu, gol |
PDB Entry: 1w6w (more details), 2.2 Å
SCOP Domain Sequences for d1w6wa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6wa3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr iaatfgpysgryvwhchilehedydmmrpmditd
Timeline for d1w6wa3: