Lineage for d1w6wa3 (1w6w A:357-510)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 792039Protein Spore coat protein A, CotA [89219] (1 species)
  7. 792040Species Bacillus subtilis [TaxId:1423] [89220] (12 PDB entries)
    Uniprot P07788
  8. 792049Domain d1w6wa3: 1w6w A:357-510 [120677]
    automatically matched to d1gska3
    complexed with azi, cu, gol

Details for d1w6wa3

PDB Entry: 1w6w (more details), 2.2 Å

PDB Description: 3d structure of cota incubated with sodium azide
PDB Compounds: (A:) spore coat protein a

SCOP Domain Sequences for d1w6wa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6wa3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]}
sypsvqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptr
gthpihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlr
iaatfgpysgryvwhchilehedydmmrpmditd

SCOP Domain Coordinates for d1w6wa3:

Click to download the PDB-style file with coordinates for d1w6wa3.
(The format of our PDB-style files is described here.)

Timeline for d1w6wa3: