Class b: All beta proteins [48724] (177 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.3: Multidomain cupredoxins [49550] (8 proteins) |
Protein Spore coat protein A, CotA [89219] (2 species) |
Species Bacillus subtilis [TaxId:1423] [89220] (13 PDB entries) Uniprot P07788 |
Domain d1w6wa1: 1w6w A:2-182 [120675] automated match to d1gska1 complexed with azi, cu, gol |
PDB Entry: 1w6w (more details), 2.2 Å
SCOPe Domain Sequences for d1w6wa1:
Sequence, based on SEQRES records: (download)
>d1w6wa1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgypea wfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekr l
>d1w6wa1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie vkrnenvyvkwmnnlpsthflpidhtihepevktvvhlhggvtpddsdgypeawfskdfe qtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrl
Timeline for d1w6wa1: