Lineage for d1w6va1 (1w6v A:1-120)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741848Fold d.324: DUSP-like [143790] (1 superfamily)
    alpha-beta-alpha-X-beta-alpha-beta; three-helical bundle capped at one end by antiparallel beta-sheet, order: 213
  4. 741849Superfamily d.324.1: DUSP-like [143791] (1 family) (S)
  5. 741850Family d.324.1.1: DUSP, domain in ubiquitin-specific proteases [143792] (1 protein)
    Pfam PF06337 (DUF1055); SMART 00695
  6. 741851Protein Ubiquitin carboxyl-terminal hydrolase 15 [143793] (1 species)
  7. 741852Species Human (Homo sapiens) [TaxId:9606] [143794] (1 PDB entry)
  8. 741853Domain d1w6va1: 1w6v A:1-120 [120674]

Details for d1w6va1

PDB Entry: 1w6v (more details)

PDB Description: solution structure of the dusp domain of husp15
PDB Compounds: (A:) ubiquitin carboxyl-terminal hydrolase 15

SCOP Domain Sequences for d1w6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6va1 d.324.1.1 (A:1-120) Ubiquitin carboxyl-terminal hydrolase 15 {Human (Homo sapiens) [TaxId: 9606]}
maeggaadldtqrsdiatllktslrkgdtwylvdsrwfkqwkkyvgfdswdkyqmgdqnv
ypgpidnsgllkdgdaqslkehlideldyillptegwnklvswytlmegqepiarkvveq

SCOP Domain Coordinates for d1w6va1:

Click to download the PDB-style file with coordinates for d1w6va1.
(The format of our PDB-style files is described here.)

Timeline for d1w6va1: