SCOP 1.73: Domain d1w6ic1: 1w6i C:1-329

Lineage for d1w6ic1 (1w6i C:1-329)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium falciparum, plasmepsin II [TaxId:5833] [50674] (16 PDB entries)

8. Domain d1w6ic1: 1w6i C:1-329 [120666]
   automatically matched to d1lf3a_
   complexed with ihn

Details for d1w6ic1

PDB Entry: 1w6i, 2.7 Å

PDB Description: plasmepsin ii-pepstatin a complex

PDB Compounds: (C:) plasmepsin 2 precursor

SCOP Domain Sequences for d1w6ic1:

Sequence; same for both SEQRES and ATOM records:

>d1w6ic1 b.50.1.2 (C:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]}
ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
lgdpfmrkyftvfdydnhsvgialakknl

Timeline for d1w6ic1:

• d1w6ic1 is new in SCOP 1.73
  
• d1w6ic1 appears in SCOP 1.75
  
• d1w6ic1 appears in the current release, SCOPe 2.08, called d1w6ic_