SCOPe 2.01: Domain d1w6ga2: 1w6g A:9-96

Lineage for d1w6ga2 (1w6g A:9-96)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (39 PDB entries)
   Uniprot P46881 9-628

8. Domain d1w6ga2: 1w6g A:9-96 [120661]
   Other proteins in same PDB: d1w6ga1
   automatically matched to d1av4_2
   complexed with cu, gol, na, so4

Details for d1w6ga2

PDB Entry: 1w6g, 1.55 Å

PDB Description: agao holoenzyme at 1.55 angstroms

PDB Compounds: (A:) phenylethylamine oxidase

SCOPe Domain Sequences for d1w6ga2:

Sequence; same for both SEQRES and ATOM records:

>d1w6ga2 d.17.2.1 (A:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

Timeline for d1w6ga2:

• d1w6ga2 first appeared in SCOP 1.73
  
• d1w6ga2 appears in SCOP 1.75
  
• d1w6ga2 appears in SCOPe 2.02
  
• d1w6ga2 appears in the current release, SCOPe 2.08