![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (16 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein) fold similar to that of the factor XIII catalytic domain |
![]() | Protein Arylamine N-acetyltransferase [54048] (4 species) |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries) |
![]() | Domain d1w6fc1: 1w6f C:4-275 [120658] automatically matched to d1gx3a_ complexed with isz |
PDB Entry: 1w6f (more details), 2.1 Å
SCOP Domain Sequences for d1w6fc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w6fc1 d.3.1.5 (C:4-275) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]} dlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklvd rrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadgr ylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytfttep rpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsaa qvldaivnrfgidlgdlagrdvqarvaevldt
Timeline for d1w6fc1: