Lineage for d1w6fc1 (1w6f C:4-275)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715528Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
    fold similar to that of the factor XIII catalytic domain
  6. 715529Protein Arylamine N-acetyltransferase [54048] (4 species)
  7. 715530Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries)
  8. 715539Domain d1w6fc1: 1w6f C:4-275 [120658]
    automatically matched to d1gx3a_
    complexed with isz

Details for d1w6fc1

PDB Entry: 1w6f (more details), 2.1 Å

PDB Description: arylamine n-acetyltransferase from mycobacterium smegmatis with the anti-tubercular drug isoniazid bound in the active site.
PDB Compounds: (C:) arylamine n-acetyltransferase

SCOP Domain Sequences for d1w6fc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w6fc1 d.3.1.5 (C:4-275) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]}
dlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklvd
rrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadgr
ylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytfttep
rpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsaa
qvldaivnrfgidlgdlagrdvqarvaevldt

SCOP Domain Coordinates for d1w6fc1:

Click to download the PDB-style file with coordinates for d1w6fc1.
(The format of our PDB-style files is described here.)

Timeline for d1w6fc1: