SCOPe 2.08: Domain d1w6fc_: 1w6f C:

Lineage for d1w6fc_ (1w6f C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein Arylamine N-acetyltransferase [54048] (4 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries)

8. Domain d1w6fc_: 1w6f C: [120658]
   automated match to d1gx3a_
   complexed with isz

Details for d1w6fc_

PDB Entry: 1w6f, 2.1 Å

PDB Description: arylamine n-acetyltransferase from mycobacterium smegmatis with the anti-tubercular drug isoniazid bound in the active site.

PDB Compounds: (C:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d1w6fc_:

Sequence; same for both SEQRES and ATOM records:

>d1w6fc_ d.3.1.5 (C:) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]}
dlggyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklvd
rrrggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadgr
ylvdvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytfttep
rpridlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsaa
qvldaivnrfgidlgdlagrdvqarvaevldt

Timeline for d1w6fc_:

• d1w6fc_ first appeared in SCOP 1.73, called d1w6fc1
  
• d1w6fc_ appears in SCOPe 2.07