SCOP 1.73: Domain d1w6fb1: 1w6f B:7-275

Lineage for d1w6fb1 (1w6f B:7-275)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (1 protein)
   fold similar to that of the factor XIII catalytic domain

6. Protein Arylamine N-acetyltransferase [54048] (4 species)

7. Species Mycobacterium smegmatis [TaxId:1772] [75335] (3 PDB entries)

8. Domain d1w6fb1: 1w6f B:7-275 [120657]
   automatically matched to d1gx3a_
   complexed with isz

Details for d1w6fb1

PDB Entry: 1w6f, 2.1 Å

PDB Description: arylamine n-acetyltransferase from mycobacterium smegmatis with the anti-tubercular drug isoniazid bound in the active site.

PDB Compounds: (B:) arylamine n-acetyltransferase

SCOP Domain Sequences for d1w6fb1:

Sequence; same for both SEQRES and ATOM records:

>d1w6fb1 d.3.1.5 (B:7-275) Arylamine N-acetyltransferase {Mycobacterium smegmatis [TaxId: 1772]}
gyltrigldgrprpdlgtlhaivaahnrsipfenldpllgipvadlsaealfaklvdrrr
ggycyehngllgyvleelgfeverlsgrvvwmraddaplpaqthnvlsvavpgadgrylv
dvgfggqtltspirleagpvqqtrhepyrltrhgddhtlaaqvrgewqplytftteprpr
idlevgswyvsthpgshfvtgltvavvtddarynlrgrnlavhrsgatehirfdsaaqvl
daivnrfgidlgdlagrdvqarvaevldt

Timeline for d1w6fb1:

• d1w6fb1 is new in SCOP 1.73
  
• d1w6fb1 appears in SCOP 1.75
  
• d1w6fb1 appears in the current release, SCOPe 2.08, called d1w6fb_