SCOPe 2.08: Domain d1w66a1: 1w66 A:1-216

Lineage for d1w66a1 (1w66 A:1-216)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.3: LplA-like [143642] (6 proteins)
   part of Pfam PF03099

6. Protein Lipoyltransferase LipB [143643] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [143644] (1 PDB entry)
   Uniprot Q10404 1-216

8. Domain d1w66a1: 1w66 A:1-216 [120652]
   Other proteins in same PDB: d1w66a2
   complexed with dka

Details for d1w66a1

PDB Entry: 1w66, 1.08 Å

PDB Description: structure of a lipoate-protein ligase b from mycobacterium tuberculosis

PDB Compounds: (A:) lipoyltransferase

SCOPe Domain Sequences for d1w66a1:

Sequence; same for both SEQRES and ATOM records:

>d1w66a1 d.104.1.3 (A:1-216) Lipoyltransferase LipB {Mycobacterium tuberculosis [TaxId: 1773]}
magsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrrte
therpidgtpvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvcadl
glhagrvdgrsgvwlpgrparkvaaigvrvsrattlhgfalncdcdlaaftaivpcgisd
aavtslsaelgrtvtvdevratvaaavcaaldgvlp

Timeline for d1w66a1:

• d1w66a1 first appeared in SCOP 1.73
  
• d1w66a1 appears in SCOPe 2.07