![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
![]() | Protein Lipoyltransferase LipB [143643] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [143644] (1 PDB entry) Uniprot Q10404 1-216 |
![]() | Domain d1w66a1: 1w66 A:1-216 [120652] Other proteins in same PDB: d1w66a2 complexed with dka |
PDB Entry: 1w66 (more details), 1.08 Å
SCOPe Domain Sequences for d1w66a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w66a1 d.104.1.3 (A:1-216) Lipoyltransferase LipB {Mycobacterium tuberculosis [TaxId: 1773]} magsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrrte therpidgtpvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvcadl glhagrvdgrsgvwlpgrparkvaaigvrvsrattlhgfalncdcdlaaftaivpcgisd aavtslsaelgrtvtvdevratvaaavcaaldgvlp
Timeline for d1w66a1: