Lineage for d1w66a1 (1w66 A:1-216)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2967966Family d.104.1.3: LplA-like [143642] (6 proteins)
    part of Pfam PF03099
  6. 2967977Protein Lipoyltransferase LipB [143643] (1 species)
  7. 2967978Species Mycobacterium tuberculosis [TaxId:1773] [143644] (1 PDB entry)
    Uniprot Q10404 1-216
  8. 2967979Domain d1w66a1: 1w66 A:1-216 [120652]
    Other proteins in same PDB: d1w66a2
    complexed with dka

Details for d1w66a1

PDB Entry: 1w66 (more details), 1.08 Å

PDB Description: structure of a lipoate-protein ligase b from mycobacterium tuberculosis
PDB Compounds: (A:) lipoyltransferase

SCOPe Domain Sequences for d1w66a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w66a1 d.104.1.3 (A:1-216) Lipoyltransferase LipB {Mycobacterium tuberculosis [TaxId: 1773]}
magsirsklsaidvrqlgtvdyrtawqlqreladarvaggadtllllehpavytagrrte
therpidgtpvvdtdrggkitwhgpgqlvgypiiglaepldvvnyvrrleesliqvcadl
glhagrvdgrsgvwlpgrparkvaaigvrvsrattlhgfalncdcdlaaftaivpcgisd
aavtslsaelgrtvtvdevratvaaavcaaldgvlp

SCOPe Domain Coordinates for d1w66a1:

Click to download the PDB-style file with coordinates for d1w66a1.
(The format of our PDB-style files is described here.)

Timeline for d1w66a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w66a2