Lineage for d1w60b1 (1w60 B:1-126)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 733777Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 733778Superfamily d.131.1: DNA clamp [55979] (2 families) (S)
  5. 733819Family d.131.1.2: DNA polymerase processivity factor [55983] (4 proteins)
    duplication: consists of two domains of this fold
  6. 733841Protein Proliferating cell nuclear antigen (PCNA) [55989] (5 species)
  7. 733882Species Human (Homo sapiens) [TaxId:9606] [55991] (7 PDB entries)
  8. 733923Domain d1w60b1: 1w60 B:1-126 [120650]
    automatically matched to d1axca1

Details for d1w60b1

PDB Entry: 1w60 (more details), 3.15 Å

PDB Description: native human pcna
PDB Compounds: (B:) Proliferating Cell Nuclear Antigen

SCOP Domain Sequences for d1w60b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w60b1 d.131.1.2 (B:1-126) Proliferating cell nuclear antigen (PCNA) {Human (Homo sapiens) [TaxId: 9606]}
mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdty
rcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmd
ldveql

SCOP Domain Coordinates for d1w60b1:

Click to download the PDB-style file with coordinates for d1w60b1.
(The format of our PDB-style files is described here.)

Timeline for d1w60b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w60b2