Lineage for d1w60a2 (1w60 A:127-255)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2215792Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 2215793Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 2216175Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 2216176Protein automated matches [226907] (20 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [254935] (3 PDB entries)
  8. 2216289Domain d1w60a2: 1w60 A:127-255 [120649]
    automated match to d1plqa2

Details for d1w60a2

PDB Entry: 1w60 (more details), 3.15 Å

PDB Description: native human pcna
PDB Compounds: (A:) Proliferating Cell Nuclear Antigen

SCOPe Domain Sequences for d1w60a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w60a2 d.131.1.0 (A:127-255) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqts
nvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmgh
lkyylapki

SCOPe Domain Coordinates for d1w60a2:

Click to download the PDB-style file with coordinates for d1w60a2.
(The format of our PDB-style files is described here.)

Timeline for d1w60a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w60a1